discontinued

NBP1-70444 C19orf18 antibody

See related secondary antibodies

Search for all "C19orf18"

Quick Overview

Rabbit anti Human C19orf18

Product Description for C19orf18

Rabbit anti Human C19orf18.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for C19orf18

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Uncharacterized protein C19orf18
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEA5
Immunogen:
Synthetic peptides corresponding to C19orf18 (chromosome 19 open reading frame 18) The peptide sequence was selected from the N terminal of C19orf18. Peptide sequence NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK.
GeneID:
147685
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 147685

Accessory Products

Proteins and/or Positive Controls

Positive controls for C19orf18 (1 products)

Catalog No. Species Pres. Purity   Source  

C19orf18 overexpression lysate

C19orf18 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn