TA346834 TGS1 antibody

Rabbit Polyclonal Anti-TGS1 Antibody

See related secondary antibodies

Search for all "TGS1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TGS1

TA346834

Product Description for TGS1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TGS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TGS1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HCA137, NCOA6IP, PIMT, Trimethylguanosine synthase homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96RS0
Immunogen:
The immunogen for anti-TGS1 antibody: synthetic peptide directed towards the middle region of human TGS1. Synthetic peptide located within the following region: IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY.
GeneID:
96764
Application WB
Background TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TGS1 (2 products)

Catalog No. Species Pres. Purity   Source  

TGS1

TGS1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TGS1

TGS1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn