TA346860 MATN1 antibody

Rabbit Polyclonal Anti-MATN1 Antibody

See related secondary antibodies

Search for all "MATN1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat MATN1

Product Description for MATN1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat MATN1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MATN1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for anti-MATN1 antibody: synthetic peptide directed towards the middle region of human MATN1. Synthetic peptide located within the following region: KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA.
GeneID:
4146
Application WB
Background This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene ha
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn