TA346825 QTRTD1 antibody

Rabbit Polyclonal Anti-QTRTD1 Antibody

See related secondary antibodies

Search for all "QTRTD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat QTRTD1

Product Description for QTRTD1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat QTRTD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for QTRTD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Queuine tRNA-ribosyltransferase subunit QTRTD1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H974
Immunogen:
The immunogen for anti-QTRTD1 antibody: synthetic peptide directed towards the N terminal of human QTRTD1. Synthetic peptide located within the following region: YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI.
GeneID:
79691
Application WB
Background This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine, and tyrosine. The encoded protein may play a role in the queuosine 5'-monophosphate salvage pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for QTRTD1 (5 products)

Catalog No. Species Pres. Purity   Source  

QTRTD1

QTRTD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

QTRTD1 (1-415, His-tag)

QTRTD1 Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

QTRTD1 (1-415, His-tag)

QTRTD1 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

QTRTD1

QTRTD1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

QTRTD1

QTRTD1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for QTRTD1 (2 products)

Catalog No. Species Pres. Purity   Source  

QTRTD1 293T Cell Transient Overexpression Lysate(Denatured)

QTRTD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

QTRTD1 Lysate

Western Blot: QTRTD1 Lysate [NBL1-15035] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for QTRTD1.
  Novus Biologicals Inc.
  • LinkedIn