TA346789 NSUN2 antibody

Rabbit Polyclonal Anti-NSUN2 Antibody

See related secondary antibodies

Search for all "NSUN2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NSUN2

Product Description for NSUN2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NSUN2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NSUN2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NOL1/NOP2/Sun domain family member 2, SAKI, Substrate of AIM1/Aurora kinase B, TRM4, tRNA (cytosine-5-)-methyltransferase, tRNA (cytosine-5-)-methyltransferase NSUN2, tRNA methyltransferase 4 homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q08J23
Immunogen:
The immunogen for anti-NSUN2 antibody: synthetic peptide directed towards the C terminal of human NSUN2. Synthetic peptide located within the following region: FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP.
GeneID:
54888
Application WB
Background This gene encodes a methyltransferase that catalyzes the methylation of cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. This modification is necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Mar 2011].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NSUN2 (1 products)

Catalog No. Species Pres. Purity   Source  

NSUN2

NSUN2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for NSUN2 (2 products)

Catalog No. Species Pres. Purity   Source  

NSUN2 Lysate

Western Blot: NSUN2 Lysate [NBL1-13814] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NSUN2
  Novus Biologicals Inc.

NSUN2 overexpression lysate

NSUN2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn