TA346781 POLR1D antibody

Rabbit Polyclonal Anti-POLR1D Antibody

See related secondary antibodies

Search for all "POLR1D"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Rabbit POLR1D

TA346781

Product Description for POLR1D

Rabbit anti Bovine, Canine, Human, Rabbit POLR1D.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POLR1D

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA-directed RNA polymerase I subunit D, DNA-directed RNA polymerases I and III subunit RPAC2, RNA polymerase I 16 kDa subunit, RNA polymerases I and III subunit AC2, RPA16, RPC16, hRPA19
Presentation Purified
Reactivity Bov, Can, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2S0
Immunogen:
The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF.
GeneID:
51082
Application WB
Background The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POLR1D (4 products)

Catalog No. Species Pres. Purity   Source  

POLR1D (transcript variant 1)

POLR1D Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POLR1D (transcript variant 2)

POLR1D Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POLR1D

POLR1D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POLR1D

POLR1D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for POLR1D (4 products)

Catalog No. Species Pres. Purity   Source  

POLR1D 293T Cell Transient Overexpression Lysate(Denatured)

POLR1D 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

POLR1D Lysate

Western Blot: POLR1D Lysate [NBL1-14576] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for POLR1D
  Novus Biologicals Inc.

POLR1D Lysate

Western Blot: POLR1D Lysate [NBL1-14577] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for POLR1D.
  Novus Biologicals Inc.

POLR1D overexpression lysate

POLR1D overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn