TA346762 STK38 antibody

Rabbit Polyclonal Anti-STK38 Antibody

See related secondary antibodies

Search for all "STK38"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish STK38

Product Description for STK38

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish STK38.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for STK38

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for anti-STK38 antibody: synthetic peptide directed towards the C terminal of human STK38. Synthetic peptide located within the following region: IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD.
GeneID:
11329
Application WB
Background STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn