TA346736 POLRMT antibody

Rabbit Polyclonal Anti-POLRMT Antibody

See related secondary antibodies

Search for all "POLRMT"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Yeast POLRMT

Product Description for POLRMT

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Yeast POLRMT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POLRMT

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA-directed RNA polymerase, MtRPOL
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00411
Immunogen:
The immunogen for Anti-POLRMT antibody is: synthetic peptide directed towards the C-terminal region of Human POLRMT. Synthetic peptide located within the following region: ALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLE.
GeneID:
5442
Application WB
Background This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POLRMT (5 products)

Catalog No. Species Pres. Purity   Source  

POLRMT

POLRMT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POLRMT

POLRMT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POLRMT

POLRMT Human Purified
  Abnova Taiwan Corp.

POLRMT

POLRMT Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POLRMT

POLRMT Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for POLRMT (2 products)

Catalog No. Species Pres. Purity   Source  

mtRNA polymerase Lysate

Western Blot: mtRNA polymerase Lysate [NBL1-14597] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for POLRMT.
  Novus Biologicals Inc.

POLRMT 293T Cell Transient Overexpression Lysate(Denatured)

POLRMT 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn