TA346687 POLR3H antibody

Rabbit Polyclonal Anti-POLR3H Antibody

See related secondary antibodies

Search for all "POLR3H"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat POLR3H

Product Description for POLR3H

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat POLR3H.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POLR3H

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA-directed RNA polymerase III subunit H, DNA-directed RNA polymerase III subunit RPC8, KIAA1665, RNA polymerase III subunit 22.9 kDa subunit, RNA polymerase III subunit C8, RPC22.9, RPC8
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y535
Immunogen:
The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL.
GeneID:
171568
Application WB
Background POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POLR3H (5 products)

Catalog No. Species Pres. Purity   Source  

POLR3H (transcript variant 3)

POLR3H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POLR3H (1-204, His-tag)

POLR3H Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

POLR3H (1-204, His-tag)

POLR3H Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

POLR3H

POLR3H Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POLR3H

POLR3H Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for POLR3H (3 products)

Catalog No. Species Pres. Purity   Source  

POLR3H Lysate

Western Blot: POLR3H Lysate [NBL1-14595] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for POLR3H
  Novus Biologicals Inc.

POLR3H Lysate

Western Blot: POLR3H Lysate [NBL1-14596] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for POLR3H
  Novus Biologicals Inc.

POLR3H overexpression lysate

POLR3H overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn