TA346654 TECR / GPSN2 antibody

Rabbit Polyclonal Anti-GPSN2 Antibody

See related secondary antibodies

Search for all "TECR / GPSN2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish TECR / GPSN2

Product Description for TECR / GPSN2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish TECR / GPSN2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TECR / GPSN2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-enoyl-CoA reductase, Synaptic glycoprotein SC2, Trans-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZ01
Immunogen:
The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the C terminal of human GPSN2. Synthetic peptide located within the following region: LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV.
GeneID:
9524
Application WB
Background This gene encodes a multi-pass membrane protein that resides in the endoplasmic reticulum, and belongs to the steroid 5-alpha reductase family. The elongation of microsomal long and very long chain fatty acid consists of 4 sequential reactions. This protein catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Apr 2011].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TECR / GPSN2 (3 products)

Catalog No. Species Pres. Purity   Source  

TECR / GPSN2

TECR / GPSN2 Human in vitro transl.
  Abnova Taiwan Corp.

TECR / GPSN2

TECR / GPSN2 Human in vitro transl.
  Abnova Taiwan Corp.

TECR / GPSN2

TECR / GPSN2 Human in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn