TA346554 ACAA1 antibody

Rabbit Polyclonal Anti-ACAA1 Antibody

See related secondary antibodies

Search for all "ACAA1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ACAA1

TA346554

More Views

  • TA346554
  • TA346554

Product Description for ACAA1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ACAA1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ACAA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-ketoacyl-CoA thiolase peroxisomal, Acetyl-CoA acyltransferase, Beta-ketothiolase, PTHIO, Peroxisomal 3-oxoacyl-CoA thiolase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P09110
Immunogen:
The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD.
GeneID:
30
Application WB
IHC
Background Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30kD subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs. Multiple alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ACAA1 (9 products)

Catalog No. Species Pres. Purity   Source  

ACAA1 (transcript variant 1)

ACAA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ACAA1 (27-424, His-tag)

ACAA1 Human Purified > 95 % by SDS – PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ACAA1 (27-424, His-tag)

ACAA1 Human Purified > 95 % by SDS – PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ACAA1

ACAA1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACAA1

ACAA1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACAA1

ACAA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACAA1

ACAA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACAA1

ACAA1 Human Purified
  Novus Biologicals Inc.

ACAA1

ACAA1 Human Purified
  Novus Biologicals Inc.

Positive controls for ACAA1 (3 products)

Catalog No. Species Pres. Purity   Source  

ACAA1 293T Cell Transient Overexpression Lysate(Denatured)

ACAA1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ACAA1 Lysate

Western Blot: ACAA1 Lysate [NBL1-07216] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACAA1 Protein
  Novus Biologicals Inc.

ACAA1 overexpression lysate

ACAA1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn