TA346556 AKR1B1 / ALDR1 antibody

Rabbit Polyclonal Anti-AKR1B1 Antibody

See related secondary antibodies

Search for all "AKR1B1 / ALDR1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish AKR1B1 / ALDR1

Product Description for AKR1B1 / ALDR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish AKR1B1 / ALDR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AKR1B1 / ALDR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Aldose reductase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P15121
Immunogen:
The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI.
GeneID:
231
Application WB
Background This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq, Feb 2009].
Format
Purification:
Protein A purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AKR1B1 / ALDR1 (10 products)

Catalog No. Species Pres. Purity   Source  

AKR1B1 / ALDR1 (1-316)

Recombinant human Aldose reductase, aa 1-316: 15% SDS-PAGE (3 µg). Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €600.00
  OriGene Technologies GmbH

AKR1B1 / ALDR1 (1-316)

Recombinant human Aldose reductase, aa 1-316: 15% SDS-PAGE (3 µg). Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €250.00
  OriGene Technologies GmbH

AKR1B1 / ALDR1

AKR1B1 / ALDR1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

AKR1B1 / ALDR1

AKR1B1 / ALDR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AKR1B1 / ALDR1

AKR1B1 / ALDR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AKR1B1 / ALDR1

AKR1B1 / ALDR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AKR1B1 / ALDR1

AKR1B1 / ALDR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AKR1B1 / ALDR1

AKR1B1 / ALDR1 Human
  Abnova Taiwan Corp.

AKR1B1 / ALDR1

AKR1B1 / ALDR1 Human
  Abnova Taiwan Corp.

AKR1B1 / ALDR1

SDS-Page: AKR1B1 Protein [NBC1-22925] - Aldose reductase, 35.8kDa (316aa) , confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for AKR1B1 / ALDR1 (1 products)

Catalog No. Species Pres. Purity   Source  

AKR1B1 / ALDR1 Lysate(Denatured)

AKR1B1 / ALDR1 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn