TA346501 PPP2R5A antibody

Rabbit Polyclonal Anti-PPP2R5A Antibody

See related secondary antibodies

Search for all "PPP2R5A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PPP2R5A

TA346501

More Views

  • TA346501

Product Description for PPP2R5A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PPP2R5A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PPP2R5A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PP2A B subunit B'alpha isoform, PP2A B subunit B56 alpha isoform, PP2A B subunit PR61 alpha isoform, PP2A B subunit R5 alpha isoform, Protein phosphatase 2A, Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15172
Immunogen:
The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW.
GeneID:
5525
Application WB
Background The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Alternative transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PPP2R5A (7 products)

Catalog No. Species Pres. Purity   Source  

PPP2R5A

PPP2R5A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PPP2R5A

PPP2R5A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PPP2R5A

PPP2R5A Human Purified
  Abnova Taiwan Corp.

PPP2R5A

PPP2R5A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PPP2R5A

PPP2R5A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PPP2R5A

PPP2R5A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPP2R5A

PPP2R5A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PPP2R5A (1 products)

Catalog No. Species Pres. Purity   Source  

PPP2R5A 293T Cell Transient Overexpression Lysate(Denatured)

PPP2R5A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn