TA346514 IL28RA antibody

Rabbit Polyclonal Anti-IL28RA Antibody

See related secondary antibodies

Search for all "IL28RA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit, Rat IL28RA

Product Description for IL28RA

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit, Rat IL28RA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IL28RA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, IFNLR1, IL-28 receptor subunit alpha, IL-28R-alpha, IL-28RA, Interferon lambda receptor 1, Interleukin-28 receptor alpha chain, LICR2, Likely interleukin or cytokine receptor 2
Presentation Purified
Reactivity Bov, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IU57
Immunogen:
The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV.
GeneID:
163702
Application WB
Background The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IL28RA (2 products)

Catalog No. Species Pres. Purity   Source  

IL28RA

IL28RA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IL28RA

IL28RA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IL28RA (1 products)

Catalog No. Species Pres. Purity   Source  

IFNLR1 overexpression lysate

IFNLR1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn