TA346399 GEM / KIR antibody

Rabbit Polyclonal Anti-GEM Antibody

See related secondary antibodies

Search for all "GEM / KIR"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GEM / KIR

TA346399

More Views

  • TA346399
  • TA346399

Product Description for GEM / KIR

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GEM / KIR.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GEM / KIR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTP-binding mitogen-induced T-cell protein, GTP-binding protein GEM, RAS-like protein KIR
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P55040
Immunogen:
The immunogen for anti-GEM antibody: synthetic peptide directed towards the C terminal of human GEM. Synthetic peptide located within the following region: ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW.
GeneID:
2669
Application WB
IHC
Background GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Format
Purification:
Protein A Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GEM / KIR (4 products)

Catalog No. Species Pres. Purity   Source  

GEM / KIR (transcript variant 2)

GEM / KIR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GEM / KIR (transcript variant 1)

GEM / KIR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GEM / KIR

GEM / KIR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GEM / KIR

GEM / KIR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GEM / KIR (1 products)

Catalog No. Species Pres. Purity   Source  

GEM Lysate

Western Blot: GEM Lysate [NBL1-11037] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GEM
  Novus Biologicals Inc.
  • LinkedIn