TA346362 PLPP1 antibody

Rabbit Polyclonal Anti-PPAP2A Antibody

See related secondary antibodies

Search for all "PLPP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PLPP1

Product Description for PLPP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PLPP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PLPP1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL.
GeneID:
8611
Application WB
Background PPAP2A is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of PPAP2A is found to be regulated by androgen in a prostatic adenocarcinoma cell line.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn