TA346325 Neurotensin receptor 1 antibody

Rabbit Polyclonal Anti-NTSR1 Antibody

See related secondary antibodies

Search for all "Neurotensin receptor 1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish Neurotensin receptor 1

TA346325

More Views

  • TA346325

Product Description for Neurotensin receptor 1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish Neurotensin receptor 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Neurotensin receptor 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms High-affinity levocabastine-insensitive neurotensin, NT-R-1, NTR1, NTRR, NTSR1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P30989
Immunogen:
The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT.
GeneID:
4923
Application WB
Background Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secre
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Neurotensin receptor 1 (1 products)

Catalog No. Species Pres. Purity   Source  

Neurotensin receptor 1

Neurotensin receptor  1 Human
  Abnova Taiwan Corp.

Positive controls for Neurotensin receptor 1 (1 products)

Catalog No. Species Pres. Purity   Source  

NTSR1 overexpression lysate

NTSR1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn