TA346318 Glutathione peroxidase 2 / GPX2 antibody

Rabbit Polyclonal Anti-GPX2 Antibody

See related secondary antibodies

Search for all "Glutathione peroxidase 2 / GPX2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish Glutathione peroxidase 2 / GPX2

Product Description for Glutathione peroxidase 2 / GPX2

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish Glutathione peroxidase 2 / GPX2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Glutathione peroxidase 2 / GPX2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GPRP, GPx-2, GSHPx-2, Gastrointestinal glutathione peroxidase, Glutathione peroxidase-related protein 2
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P18283
Immunogen:
The immunogen for anti-GPX2 antibody: synthetic peptide directed towards the middle region of human GPX2. Synthetic peptide located within the following region: GGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLII.
GeneID:
2877
Application WB
Background This gene is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Glutathione peroxidase 2 / GPX2 (3 products)

Catalog No. Species Pres. Purity   Source  

Glutathione peroxidase 2 / GPX2 (1-190, His-tag)

Glutathione peroxidase 2 / GPX2 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €820.00
  OriGene Technologies GmbH

Glutathione peroxidase 2 / GPX2 (1-190, His-tag)

Glutathione peroxidase 2 / GPX2 Human Purified > 95 % by SDS - PAGE E. coli
10 µg / €320.00
  OriGene Technologies GmbH

Glutathione peroxidase 2 / GPX2

Glutathione peroxidase 2 / GPX2 Human
  Abnova Taiwan Corp.

Positive controls for Glutathione peroxidase 2 / GPX2 (2 products)

Catalog No. Species Pres. Purity   Source  

Glutathione Peroxidase 2 Lysate

Western Blot: Glutathione Peroxidase 2 Lysate [NBL1-11315] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GPX2
  Novus Biologicals Inc.

GPX2 overexpression lysate

GPX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn