TA346262 RPAIN antibody

Rabbit Polyclonal Anti-RPAIN Antibody

See related secondary antibodies

Search for all "RPAIN"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat RPAIN

TA346262

Product Description for RPAIN

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat RPAIN.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPAIN

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for anti-RPAIN antibody: synthetic peptide directed towards the C terminal of human RPAIN. Synthetic peptide located within the following region: VVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEE.
GeneID:
84268
Application WB
Background RPAIN mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn