CD40 - TA346282 | acris-antibodies.com

Product Description for CD40

Rabbit anti Human, Rabbit CD40.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD40

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, TNFRSF5, Tumor necrosis factor receptor superfamily member 5
Presentation	Purified
Reactivity	Hu, Rb
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P25942 Immunogen: The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV. GeneID: 958
Application	WB
Background	CD40 is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Format	Purification: Affinity Purified Buffer System: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD40 (16 products)

Catalog No.	Species	Pres.	Purity	Source
TP720633	CD40 (transcript variant 1)
	Human		> 95 % Preparation: . Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	10 µg / €299.00
					OriGene Technologies, Inc.
TP720781	CD40 (transcript variant 1)
	Human		> 95 % Preparation: . Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells
					OriGene Technologies, Inc.
AR51435PU-N	CD40 (21-193, His-tag)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	0.25 mg / €820.00
					OriGene Technologies GmbH
AR51435PU-S	CD40 (21-193, His-tag)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	50 µg / €320.00
					OriGene Technologies GmbH
H00000958-G01	CD40
	Human
					Abnova Taiwan Corp.
H00000958-H01	CD40
	Human			Human HEK293T cells
					Abnova Taiwan Corp.
H00000958-P01-10	CD40
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000958-P01-25	CD40
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000958-P02	CD40
	Human	Purified
					Abnova Taiwan Corp.
H00000958-P02-10	CD40
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000958-P02-25	CD40
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000958-P03	CD40
	Human	Purified
					Abnova Taiwan Corp.
H00000958-P03-10	CD40
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00000958-P03-25	CD40
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
NBP1-46044	CD40
	Human	Purified
					Novus Biologicals Inc.
NBP1-46078	CD40
	Human	Purified
					Novus Biologicals Inc.

Positive controls for CD40 (2 products)

Catalog No.	Species
H00000958-T01	CD40 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-08948	CD40 Lysate

		Novus Biologicals Inc.

Recommended Secondary Antibodies for CD40 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH