TA346136 CHST7 antibody

Rabbit Polyclonal Anti-CHST7 Antibody

See related secondary antibodies

Search for all "CHST7"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CHST7

Product Description for CHST7

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CHST7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CHST7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6ST-2, C6ST2, Carbohydrate sulfotransferase 7, Chondroitin 6-sulfotransferase 2, GST-5, GST5, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 5, GlcNAc6ST-4, Gn6st-4, N-acetylglucosamine 6-O-sulfotransferase 1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NS84
Immunogen:
The immunogen for anti-CHST7 antibody: synthetic peptide directed towards the middle region of human CHST7. Synthetic peptide located within the following region: DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR.
GeneID:
56548
Application WB
Background CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.This gene belongs to the sulfotransferase gene family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This gene product mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of this gene family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes. This gene is part of a gene cluster on chromosome Xp11.23.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CHST7 (1 products)

Catalog No. Species Pres. Purity   Source  

CHST7 overexpression lysate

CHST7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn