TA346142 GGTLC1 / GGTLA4 antibody

Rabbit Polyclonal Anti-GGTLA4 Antibody

See related secondary antibodies

Search for all "GGTLC1 / GGTLA4"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat GGTLC1 / GGTLA4

TA346142

More Views

  • TA346142

Product Description for GGTLC1 / GGTLA4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat GGTLC1 / GGTLA4.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GGTLC1 / GGTLA4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Gamma-glutamyltransferase light chain 1, Gamma-glutamyltransferase-like activity 4, Gamma-glutamyltransferase-like protein 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BX51
Immunogen:
The immunogen for anti-GGTLA4 antibody: synthetic peptide directed towards the C terminal of human GGTLA4. Synthetic peptide located within the following region: DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY.
GeneID:
92086
Application WB
IHC
Background Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein encoded by this gene is similar in sequence to several members of the gamma-glutamyl transpeptidase family. Three transcript variants encoding the same protein have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GGTLC1 / GGTLA4 (2 products)

Catalog No. Species Pres. Purity   Source  

GGTLC1 / GGTLA4

GGTLC1 / GGTLA4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GGTLC1 / GGTLA4

GGTLC1 / GGTLA4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GGTLC1 / GGTLA4 (2 products)

Catalog No. Species Pres. Purity   Source  

GGTLA4 293T Cell Transient Overexpression Lysate(Denatured)

GGTLA4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GGTLC1 overexpression lysate

GGTLC1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn