TA346095 SFTPC antibody

Rabbit Polyclonal Anti-SFTPC Antibody

See related secondary antibodies

Search for all "SFTPC"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep SFTPC

Product Description for SFTPC

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep SFTPC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SFTPC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SFTP2, SP-C, SP5, Surfactant protein C
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P11686
Immunogen:
The immunogen for anti-SFTPC antibody: synthetic peptide directed towards the N terminal of human SFTPC. Synthetic peptide located within the following region: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI.
GeneID:
6440
Application WB
Background This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SFTPC (3 products)

Catalog No. Species Pres. Purity   Source  

SFTPC

SFTPC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SFTPC

SFTPC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SFTPC

SFTPC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SFTPC (3 products)

Catalog No. Species Pres. Purity   Source  

Prosurfactant Protein C Lysate

Western Blot: Prosurfactant Protein C Lysate [NBL1-15896] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SFTPC
  Novus Biologicals Inc.

SFTPC 293T Cell Transient Overexpression Lysate(Denatured)

SFTPC 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SFTPC overexpression lysate

SFTPC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn