TA346093 PRPS2 antibody

Rabbit Polyclonal Anti-PRPS2 Antibody

See related secondary antibodies

Search for all "PRPS2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PRPS2

Product Description for PRPS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PRPS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRPS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PPRibP, PRS-II, Phosphoribosyl pyrophosphate synthase II, Ribose-phosphate pyrophosphokinase 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P11908
Immunogen:
The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the N terminal of human PRPS2. Synthetic peptide located within the following region: MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG.
GeneID:
5634
Application WB
Background The function remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRPS2 (7 products)

Catalog No. Species Pres. Purity   Source  

PRPS2 (transcript variant 1)

PRPS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PRPS2 (1-321, His-tag)

PRPS2 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

PRPS2 (1-321, His-tag)

PRPS2 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

PRPS2

PRPS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PRPS2

PRPS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PRPS2

PRPS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PRPS2

PRPS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn