Myoglobin - TA346112 | acris-antibodies.com

Product Description for Myoglobin

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep Myoglobin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Myoglobin

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	MB
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P02144 Immunogen: The immunogen for anti-MB antibody: synthetic peptide directed towards the N terminal of human MB. Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL. GeneID: 4151
Application	WB
Background	This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.
Format	Purification: Affinity Purified Buffer System: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Myoglobin (24 products)

Catalog No.	Species	Pres.	Purity	Source
TP303113	Myoglobin (transcript variant 3)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP312352	Myoglobin (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
AR09815PU-L	Myoglobin (1-154, His-tag)
	Human	Purified	> 90 %	E. coli	0.5 mg / €1,070.00
					OriGene Technologies GmbH
AR09815PU-N	Myoglobin (1-154, His-tag)
	Human	Purified	> 90 %	E. coli	0.1 mg / €400.00
					OriGene Technologies GmbH
AR10390PU-L	Myoglobin
	Human	Purified	> 95.0% Purification Method: Proprietary chromatographic techniques.	E. coli
					OriGene Technologies GmbH
AR10390PU-N	Myoglobin
	Human	Purified	> 95.0% Purification Method: Proprietary chromatographic techniques.	E. coli
					OriGene Technologies GmbH
AR10390PU-S	Myoglobin
	Human	Purified	> 95.0% Purification Method: Proprietary chromatographic techniques.	E. coli
					OriGene Technologies GmbH
AR10391PU-L	Myoglobin (Heme free)
	Human	Purified	> 95.0% as determined by both RP-HPLC and SDS-PAGE analysis. Purification Method: Proprietary chromatographic techniques.	E. coli
					OriGene Technologies GmbH
AR10391PU-N	Myoglobin (Heme free)
	Human	Purified	> 95.0% as determined by both RP-HPLC and SDS-PAGE analysis. Purification Method: Proprietary chromatographic techniques.	E. coli
					OriGene Technologies GmbH
AR10391PU-S	Myoglobin (Heme free)
	Human	Purified	> 95.0% as determined by both RP-HPLC and SDS-PAGE analysis. Purification Method: Proprietary chromatographic techniques.	E. coli
					OriGene Technologies GmbH
BA462	Myoglobin
	Human		> 99 % by SDS - PAGE	Heart	0.25 mg / €290.00
					OriGene Technologies GmbH
PA1332	Myoglobin
	Human	Purified	> 95 % (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE	E. coli
					OriGene Technologies GmbH
PA1332X	Myoglobin
	Human	Purified	> 95 % (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE	E. coli
					OriGene Technologies GmbH
PA1332XC	Myoglobin
	Human	Purified	> 95 % (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE	E. coli
					OriGene Technologies GmbH
H00004151-P01-10	Myoglobin
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00004151-P01-25	Myoglobin
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00004151-Q01-10	Myoglobin
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue
					Abnova Taiwan Corp.
H00004151-Q01-25	Myoglobin
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue
					Abnova Taiwan Corp.
P3564	Myoglobin
	Human
					Abnova Taiwan Corp.
P4946	Myoglobin
	Human
					Abnova Taiwan Corp.
P136-3	Myoglobin
	Human		> 96 %	Heart
					BBI Solutions
8M50	Myoglobin (cardiac)
	Human		> 98 %	Heart	1 mg / €570.00
					HyTest Ltd.
NBP1-50959-0.1	Myoglobin
	Human	Purified
					Novus Biologicals Inc.
NBP1-50959-0.5	Myoglobin
	Human	Purified
					Novus Biologicals Inc.

Positive controls for Myoglobin (7 products)

Catalog No.	Species
H00004151-T01	MB 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY404319	MB overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY404320	MB overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY417346	MB overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY430914	MB overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.
LY430915	MB overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.
NBL1-12923	Myoglobin Lysate

		Novus Biologicals Inc.

Recommended Secondary Antibodies for Myoglobin (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH