TA346817 OXCT2 / SCOTT antibody

Rabbit Polyclonal Anti-OXCT2 Antibody

See related secondary antibodies

Search for all "OXCT2 / SCOTT"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish OXCT2 / SCOTT

TA346817

More Views

  • TA346817

Product Description for OXCT2 / SCOTT

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish OXCT2 / SCOTT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OXCT2 / SCOTT

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-oxoacid-CoA transferase 2A, SCOT-T, Succinyl-CoA:3-ketoacid-coenzyme A transferase 2 mitochondrial, Testis-specific succinyl-CoA:3-oxoacid CoA-transferase
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BYC2
Immunogen:
The immunogen for anti-OXCT2 antibody: synthetic peptide directed towards the middle region of human OXCT2. Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV.
GeneID:
64064
Application WB
Background OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization. See also OXCT1 (MIM 601424).[supplied by OMIM, Mar 2008].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OXCT2 / SCOTT (2 products)

Catalog No. Species Pres. Purity   Source  

OXCT2 / SCOTT

OXCT2 / SCOTT Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OXCT2 / SCOTT

OXCT2 / SCOTT Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for OXCT2 / SCOTT (3 products)

Catalog No. Species Pres. Purity   Source  

OXCT2 293T Cell Transient Overexpression Lysate(Denatured)

OXCT2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

OXCT2 overexpression lysate

OXCT2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SCOT2 Lysate

Western Blot: SCOT2 Lysate [NBL1-14019] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for OXCT2
  Novus Biologicals Inc.
  • LinkedIn