TA346812 CHST6 antibody

Rabbit Polyclonal Anti-CHST6 Antibody

See related secondary antibodies

Search for all "CHST6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rat CHST6

Product Description for CHST6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rat CHST6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CHST6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-GlcNAc6ST, Carbohydrate sulfotransferase 6, Corneal N-acetylglucosamine-6-O-sulfotransferase, GST4-beta, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-beta, GlcNAc6ST-5, Gn6st-5, Gn6st5, N-acetylglucosamine 6-O-sulfotransferase 5, hCGn6ST
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZX3
Immunogen:
The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN.
GeneID:
4166
Application WB
Background The protein encoded by this gene is an enzyme that catalyzes the transfer of a sulfate group to the GlcNAc residues of keratan. Keratan sulfate helps maintain corneal transparency. Defects in this gene are a cause of macular corneal dystrophy (MCD). [provided by RefSeq, Jan 2010].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CHST6 (4 products)

Catalog No. Species Pres. Purity   Source  

CHST6 (full length, N-term HIS tag)

CHST6 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

CHST6

CHST6 Human
  Abnova Taiwan Corp.

CHST6

CHST6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CHST6

CHST6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CHST6 (2 products)

Catalog No. Species Pres. Purity   Source  

CHST6 Lysate

Western Blot: CHST6 Lysate [NBL1-09197] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CHST6
  Novus Biologicals Inc.

CHST6 overexpression lysate

CHST6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn