TA346810 CROT antibody

Rabbit Polyclonal Anti-CROT Antibody

See related secondary antibodies

Search for all "CROT"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish CROT

Product Description for CROT

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish CROT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CROT

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms COT, Peroxisomal carnitine O-octanoyltransferase
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKG9
Immunogen:
The immunogen for anti-CROT antibody: synthetic peptide directed towards the N terminal of human CROT. Synthetic peptide located within the following region: MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK.
GeneID:
54677
Application WB
Background This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jan 2009].
Format
Purification:
Protein A purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CROT (5 products)

Catalog No. Species Pres. Purity   Source  

CROT (transcript variant 2)

CROT Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CROT

CROT Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CROT

CROT Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CROT

CROT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CROT

CROT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CROT (3 products)

Catalog No. Species Pres. Purity   Source  

CROT 293T Cell Transient Overexpression Lysate(Denatured)

CROT 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CROT Lysate

Western Blot: CROT Lysate [NBL1-09489] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CROT
  Novus Biologicals Inc.

CROT overexpression lysate

CROT overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn