TA346816 NSUN3 antibody

Rabbit Polyclonal Anti-NSUN3 Antibody

See related secondary antibodies

Search for all "NSUN3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NSUN3

Product Description for NSUN3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NSUN3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NSUN3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NOL1/NOP2/Sun domain family member 3, Putative methyltransferase NSUN3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H649
Immunogen:
The immunogen for anti-NSUN3 antibody: synthetic peptide directed towards the C terminal of human NSUN3. Synthetic peptide located within the following region: LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP.
GeneID:
63899
Application WB
Background May have S-adenosyl-L-methionine-dependent methyl-transferase activity.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NSUN3 (3 products)

Catalog No. Species Pres. Purity   Source  

NSUN3 (full length, N-term HIS tag)

NSUN3 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

NSUN3

NSUN3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NSUN3

NSUN3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NSUN3 (2 products)

Catalog No. Species Pres. Purity   Source  

NSUN3 Lysate

Western Blot: NSUN3 Lysate [NBL1-13815] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NSUN3
  Novus Biologicals Inc.

NSUN3 overexpression lysate

NSUN3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn