TA329652 HES7 antibody

Rabbit Polyclonal anti-HES7 antibody

See related secondary antibodies

Search for all "HES7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human HES7

TA329652

More Views

  • TA329652
  • TA329652

Product Description for HES7

Rabbit anti Human HES7.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for HES7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BHLHB37, Class B basic helix-loop-helix protein 37, Hairy and enhancer of split 7, Transcription factor HES-7, bHLH factor Hes7
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BYE0
Immunogen:
The immunogen for anti-HES7 antibody: synthetic peptide directed towards the middle region of human HES7. Synthetic peptide located within the following region: VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLRLAAIAHDASP.
GeneID:
84667
Application WB
IHC
Background In mouse, Hes7 expression is associated with somitogenesis and is controlled by Notch signaling.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HES7 (2 products)

Catalog No. Species Pres. Purity   Source  

HES7 (1-230, His-tag)

HES7 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

HES7 (1-230, His-tag)

HES7 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Positive controls for HES7 (1 products)

Catalog No. Species Pres. Purity   Source  

HES7 overexpression lysate

HES7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn