TA329645 ZBTB45 antibody

Rabbit Polyclonal anti-ZNF499 antibody

See related secondary antibodies

Search for all "ZBTB45"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZBTB45

Product Description for ZBTB45

Rabbit anti Human ZBTB45.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZBTB45

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZNF499, Zinc finger and BTB domain-containing protein 45, Zinc finger protein 499
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96K62
Immunogen:
The immunogen for anti-ZNF499 antibody: synthetic peptide directed towards the middle region of human ZNF499. Synthetic peptide located within the following region: CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWHDEDGAVPEGC.
GeneID:
84878
Application WB
Background The ZNF499 gene is located on chromosome 19 and encodes a protein with unknown function.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn