TA329623 E2f7 antibody

Rabbit polyclonal anti-E2f7 antibody

See related secondary antibodies

Search for all "E2f7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse E2f7

TA329623

More Views

  • TA329623

Product Description for E2f7

Rabbit anti Mouse E2f7.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for E2f7

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Ms
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for anti-E2f7 antibody: synthetic peptide directed towards the N terminal of mouse E2f7. Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE.
GeneID:
52679
Application WB
IHC
Background E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn