TA329621 Tcfl5 antibody

Rabbit polyclonal anti-Tcfl5 Antibody

See related secondary antibodies

Search for all "Tcfl5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse Tcfl5

Product Description for Tcfl5

Rabbit anti Mouse Tcfl5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tcfl5

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for Anti-Tcfl5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tcfl5. Synthetic peptide located within the following region: EKTPGGADGTRTRADGVAKEGAGGAGPDGAPEARAKPTVRVRLEDRFNSM.
GeneID:
277353
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn