TA329600 CBFA2T2 antibody

Rabbit polyclonal anti-CBFA2T2H antibody

See related secondary antibodies

Search for all "CBFA2T2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse CBFA2T2

Product Description for CBFA2T2

Rabbit anti Mouse CBFA2T2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CBFA2T2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EHT, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, MTGR1, Myeloid translocation-related protein 1, p85
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O70374
Immunogen:
The immunogen for anti-CBFA2T2H antibody: synthetic peptide directed towards the middle region of mouse CBFA2T2H. Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS.
GeneID:
12396
Application WB
Background Mouse Cbfa2t2h associates with mSin3A, N-CoR, and histone deacetylase 3 and that when tethered to DNA, it acts as a transcriptional corepressor.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn