TA329593 TGIFX1 antibody

Rabbit polyclonal anti-Tgifx1 antibody

See related secondary antibodies

Search for all "TGIFX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse TGIFX1

Product Description for TGIFX1

Rabbit anti Mouse TGIFX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TGIFX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Testis-expressed homeobox protein Tex1, Tgif2lx, Tgif2lx1, Tgif2lx2
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8K5B9
Immunogen:
The immunogen for anti-Tgifx1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSE.
GeneID:
245583
Application WB
Background The homeobox gene superfamily is highly conserved during evolution. These members act as transcription factors during several important developmental processes through their 60 amino acid homeodomains that recognize and bind to the regulatory region of their target genes. Tgifx1, the product of a novel testis homeobox gene, may play a crucial role during spermatogenesis.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn