TA329573 CHST14 antibody

Rabbit polyclonal anti-CHST14 antibody

See related secondary antibodies

Search for all "CHST14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CHST14

TA329573

Product Description for CHST14

Rabbit anti Human CHST14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CHST14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Carbohydrate sulfotransferase 14, D4ST-1, D4ST1, Dermatan 4-sulfotransferase 1, hD4ST1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCH0
Immunogen:
The immunogen for anti-CHST14 antibody: synthetic peptide directed towards the middle region of human CHST14. Synthetic peptide located within the following region: REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM.
GeneID:
113189
Application WB
Background CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CHST14 (2 products)

Catalog No. Species Pres. Purity   Source  

CHST14

CHST14 Human Purified
  Abnova Taiwan Corp.

CHST14

CHST14 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn