TA329561 UBE2H antibody

Rabbit Polyclonal anti-Ube2h Antibody

See related secondary antibodies

Search for all "UBE2H"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse UBE2H

TA329561

Product Description for UBE2H

Rabbit anti Mouse UBE2H.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UBE2H

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E2-20K, UBCH2, Ubiquitin carrier protein H, Ubiquitin-conjugating enzyme E2 H, Ubiquitin-protein ligase H
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62257
Immunogen:
The immunogen for Anti-Ube2h antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ube2h. Synthetic peptide located within the following region: PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKV.
GeneID:
22214
Application WB
Background Ube2h accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, it catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Capable, in vitro, to ubiquitinate histone H2A.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn