TA329479 C6orf134 antibody

Rabbit Polyclonal anti-C6orf134 antibody

See related secondary antibodies

Search for all "C6orf134"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C6orf134

Product Description for C6orf134

Rabbit anti Human C6orf134.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C6orf134

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UPF0635 protein C6orf134
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SQI0
Immunogen:
The immunogen for anti-C6orf134 antibody: synthetic peptide directed towards the N terminal of human C6orf134. Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL.
GeneID:
79969
Application WB
Background The function remains unknown.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C6orf134 (3 products)

Catalog No. Species Pres. Purity   Source  

ATAT1 overexpression lysate

ATAT1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ATAT1 overexpression lysate

ATAT1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

C6orf134 Lysate

Western Blot: C6orf134 Lysate [NBL1-08514] - Western Blot experiments. Left-Control; Right -Over-expression Lysate for C6orf134. Protein
  Novus Biologicals Inc.
  • LinkedIn