TA329468 GPR87 / GPR95 antibody

Rabbit Polyclonal anti-GPR87 antibody

See related secondary antibodies

Search for all "GPR87 / GPR95"

0.1 ml / €430.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GPR87 / GPR95

Product Description for GPR87 / GPR95

Rabbit anti Human GPR87 / GPR95.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR87 / GPR95

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FKSG78, G-protein coupled receptor 87
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BY21
Immunogen:
The immunogen for anti-GPR87 antibody: synthetic peptide directed towards the N terminal of human GPR87. Synthetic peptide located within the following region: MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL.
GeneID:
53836
Application WB
Background G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for GPR87 / GPR95 (1 products)

Catalog No. Species Pres. Purity   Source  

GPR87 overexpression lysate

GPR87 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn