TA329388 SCMH1 antibody

Rabbit Polyclonal anti-SCMH1 antibody

See related secondary antibodies

Search for all "SCMH1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SCMH1

TA329388

More Views

  • TA329388

Product Description for SCMH1

Rabbit anti Human SCMH1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SCMH1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for anti-SCMH1 antibody: synthetic peptide directed towards the middle region of human SCMH1. Synthetic peptide located within the following region: LTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVLEHQPGQRGRK.
GeneID:
22955
Application WB
Background SCMH1 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn