TA329348 ZNF384 antibody

Rabbit Polyclonal anti-ZNF384 antibody

See related secondary antibodies

Search for all "ZNF384"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF384

Product Description for ZNF384

Rabbit anti Human ZNF384.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF384

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CAG repeat protein 1, CAGH1, CAS-interacting zinc finger protein, CIZ, NMP4, Nuclear matrix transcription factor 4, TNRC1, Trinucleotide repeat-containing gene 1 protein, Zinc finger protein 384
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TF68
Immunogen:
The immunogen for anti-ZNF384 antibody: synthetic peptide directed towards the middle region of human ZNF384. Synthetic peptide located within the following region: KKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQ.
GeneID:
171017
Application WB
Background The specific function of this protein remains unknownThis gene contains long CAG trinucleotide repeats coding consecutive glutamine residues. The gene product may functions as a transcription factor, with a potential role in the regulation of neurodevelopment or neuroplasticity. The protein appears to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1. Studies in mouse suggest that nuclear matrix transcription factors (NP/NMP4) may be part of a general mechanical pathway that couples cell construction and function during extracellular matrix remodeling. Multiple transcript variants encoding several isoforms have been found for this gene.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF384 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF384 overexpression lysate

ZNF384 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ZNF384 overexpression lysate

ZNF384 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn