TA329360 GATA5 antibody

Rabbit Polyclonal anti-GATA5 antibody

See related secondary antibodies

Search for all "GATA5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GATA5

TA329360

Product Description for GATA5

Rabbit anti Human GATA5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GATA5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GATA-5, GATA-binding factor 5, Transcription factor GATA-5
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BWX5
Immunogen:
The immunogen for anti-GATA5 antibody: synthetic peptide directed towards the middle region of human GATA5. Synthetic peptide located within the following region: SAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFP.
GeneID:
140628
Application WB
Background The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GATA5 (4 products)

Catalog No. Species Pres. Purity   Source  

GATA5

GATA5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GATA5

GATA5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GATA5

GATA5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GATA5

GATA5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GATA5 (1 products)

Catalog No. Species Pres. Purity   Source  

GATA5 overexpression lysate

GATA5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn