TA329258 HOXC5 / HOX3D antibody

Rabbit Polyclonal anti-HOXC5 antibody

See related secondary antibodies

Search for all "HOXC5 / HOX3D"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human HOXC5 / HOX3D

Product Description for HOXC5 / HOX3D

Rabbit anti Human HOXC5 / HOX3D.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXC5 / HOX3D

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CP11, Homeobox protein Hox-C5, Hox-3D
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q00444
Immunogen:
The immunogen for anti-HOXC5 antibody: synthetic peptide directed towards the middle region of human HOXC5. Synthetic peptide located within the following region: WMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNL.
GeneID:
3222
Application WB
Background This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXC5 / HOX3D (4 products)

Catalog No. Species Pres. Purity   Source  

HOXC5 / HOX3D

HOXC5 / HOX3D Human Purified
  Abnova Taiwan Corp.

HOXC5 / HOX3D

HOXC5 / HOX3D Human Purified
  Abnova Taiwan Corp.

HOXC5 / HOX3D

HOXC5 / HOX3D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HOXC5 / HOX3D

HOXC5 / HOX3D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for HOXC5 / HOX3D (1 products)

Catalog No. Species Pres. Purity   Source  

HOXC5 overexpression lysate

HOXC5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn