TA329269 MYF6 antibody

Rabbit Polyclonal anti-MYF6 antibody

See related secondary antibodies

Search for all "MYF6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MYF6

Product Description for MYF6

Rabbit anti Human MYF6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MYF6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BHLHC4, Class C basic helix-loop-helix protein 4, MRF4, Muscle-specific regulatory factor 4, Myf-6, Myogenic factor 6
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P23409
Immunogen:
The immunogen for anti-MYF6 antibody: synthetic peptide directed towards the middle region of human MYF6. Synthetic peptide located within the following region: LQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDH.
GeneID:
4618
Application WB
Background MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MYF6 (4 products)

Catalog No. Species Pres. Purity   Source  

MYF6

MYF6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MYF6

MYF6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MYF6

MYF6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MYF6

MYF6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MYF6 (3 products)

Catalog No. Species Pres. Purity   Source  

MYF6 293T Cell Transient Overexpression Lysate(Denatured)

MYF6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MYF6 Lysate

Western Blot: MYF6 Lysate [NBL1-13421] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MYF6
  Novus Biologicals Inc.

MYF6 overexpression lysate

MYF6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn