TA329143 PDPK1 antibody

Rabbit Polyclonal anti-PDPK1 antibody

See related secondary antibodies

Search for all "PDPK1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PDPK1

Product Description for PDPK1

Rabbit anti Human PDPK1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDPK1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-phosphoinositide-dependent proteinkinase 1, PDK-1, PDK1, PDPK1, hPDK1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15530
Immunogen:
The immunogen for anti-PDPK1 antibody: synthetic peptide directed towards the middle region of human PDPK1. Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS.
GeneID:
5170
Application WB
Background PDPK1 phosphorylates and activates not only PKB/AKT, but also PKA, PKC-zeta, RPS6KA1 and RPS6KB1. It may play a general role in signaling processes and in development.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDPK1 (13 products)

Catalog No. Species Pres. Purity   Source  

PDPK1 (transcript variant 2)

PDPK1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PDPK1

PDPK1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human in vitro transl.
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human in vitro transl.
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human
  Abnova Taiwan Corp.

PDPK1

PDPK1 Human
  Abnova Taiwan Corp.

Positive controls for PDPK1 (4 products)

Catalog No. Species Pres. Purity   Source  

PDPK1 293T Cell Transient Overexpression Lysate(Denatured)

PDPK1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PDPK1 Lysate

Western Blot: PDPK1 Lysate [NBL1-14259] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PDPK1
  Novus Biologicals Inc.

PDPK1 Lysate

Western Blot: PDPK1 Lysate [NBL1-14260] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PDPK1
  Novus Biologicals Inc.

PDPK1 overexpression lysate

PDPK1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn