TA329108 Scrt1 antibody

Rabbit Polyclonal anti-Scrt1 Antibody

See related secondary antibodies

Search for all "Scrt1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat Scrt1

Product Description for Scrt1

Rabbit anti Rat Scrt1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Scrt1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for Anti-Scrt1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Scrt1. Synthetic peptide located within the following region: MPRSFLVKKVKLDTFSSADLDSSYGRARSDLGVRLQDKGYLSDYVGPASV.
GeneID:
366951
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn