DA3526X FGFR1 (IIIC - Fc Chimera)

Search for all "FGFR1"

50 µg / €290.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

FGFR1

DA3526X

More Views

  • DA3526X
  • DA3526X

Product Description for FGFR1

FGFR1.
Presentation: Purified

Properties for FGFR1

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms BFGFR, Basic fibroblast growth factor receptor 1, CEK, FGFBR, FLG, FLT-2, FLT2, Fibroblast growth factor receptor 1, Fms-like tyrosine kinase 2, HBGFR, N-sam, Proto-oncogene c-Fgr, bFGF-R-1
Presentation Purified
Molecular weight 170 kDa
Source Insect cells
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P11362
Purity > 90 % by SDS-PAGE and visualised by silver stain.
Add. information Centrifuge vials before opening!
Background Fibroblast Growth Factors (FGFs) comprise a family of at least eighteen structurally realted proteins that are involved in a multitude of physiological and pathological cellular processes, including cell growth, differentation, angiogenesis, wound healing and tumorgenesis. The biological activities of the FGFs are mediated by a family if type I transmembrane tyrosine kinases which undergo dimerization and autophosphorylation after ligand binding. Four distinct genes encoding closely related FGF receptors, FGFR-1to -4 are known. Multiple forms of FGFR-1 to -3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGFR-1 and -2 results in receptors containing all three Ig domains, referred to as the alpha isoform, or only IgII and IgIII, referred to as the ÿ isoform. Only the alpha isoform has been identified for FGFR-3 and FGFR-4. Additional splicing events for FGFR-1 to -3, involving the C-terminal half of the IgIII domain encoded by two mutually exclusive alternative exons, generate FGF receptors with alternative IgIII domains (IIIb and IIIc). A IIIa isoform which is a secreted FGF binding protein containing only the N-terminal half of the IgIII domain plus some intron sequences has also been reported for FGFR-1. Mutations in FGFR-1 to -3 have been found in patients with birth defects involving craniosynostosis.
General Readings
  1. Eisemann et al., Oncogene 6:1195, 1991.
  2. Givol et al., FASEB J 6:3362, 1992.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Human Soluble FGFR-1/Fc Chimera.
Recombinant Human soluble FGFR-1 alpha (IIIc) was fused via a Xa cleavage site with the Fc part of Human IgG1. Human recombinant soluble FGFR-1 alpha (IIIc)/Fc is a disulfide-linked heterodimeric protein. In the reduced form the glycosylated subunits of sFGFR-1 alpha/human Fc chimera display a molecular mass of 80-85 kDa.
AA Sequence:
RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSG LYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKT VKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVE RSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEV LHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEDPRRASIEGRGDPEEPKSCDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Biological activity:
Determined by its ability to inhibit human FGF basic-dependent proliferation on HUVE cells.
Inhibition of bFGF-induced proliferation of NHDF cells by recombinant sFGFR1-Fc (Cat.-No DA3526).
Molecular weight:
(Glycosylated dimer).
Format
Buffer System:
PBS
Stabilizers:
None
Endotoxin level:
< 0.1 ng per µg of sFGF-R1a.
Purity:
>90% by SDS-PAGE and visualised by silver stain.
State:
Lyophilized purified protein.
Purified
Reconstitution:
Restore in PBS or medium to a concentration not lower than 50 µg/ml.
The lyophilized sFGFR-1 alpha (IIIc)/Fc is soluble in water and most aqueous buffers.
  • LinkedIn