DA3528X CD333 / FGFR3 (IIIC - Fc Chimera)

Search for all "CD333 / FGFR3"

50 µg / €290.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

CD333 / FGFR3

Product Description for CD333 / FGFR3

CD333 / FGFR3.
Presentation: Purified

Properties for CD333 / FGFR3

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms FGFR-3, Fibroblast growth factor receptor 3, JTK4
Presentation Purified
Molecular weight 170 kDa
Source Insect cells
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P22607
Purity > 90 % by SDS-PAGE and visualised by silver stain.
Add. information Centrifuge vials before opening!
Background Fibroblast Growth Factors (FGFs) comprise a family of at least eighteen structurally related proteins that are involved in a multitude of physiological and pathological cellular processes, including cell growth, differentiation, angiogenesis, wound healing and tumorigenesis.
The biological activities of the FGFs are mediated by a family of type I transmembrane tyrosine kinases which undergo dimerization and autophosphorylation after ligand binding. Four distinct genes encoding closely related FGF receptors, FGFR-1 to -4 are known. Multiple forms of FGFR-1 to -3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGFR-1 and -2 results in receptors containing all three Ig domains, referred to as the alpha isoform, or only IgII and IgIII, referred to as the ß isoform. Only the alpha isoform has been identified for FGFR-3 and FGFR-4. Additional splicing events for FGFR-1 to -3, involving the C-terminal half of the IgIII domain encoded by two mutually exclusive alternative exons, generate FGF receptors with alternative IgIII domains (IIIb and IIIc). A IIIa isoform which is a secreted FGF binding protein containing only the N-terminal half of the IgIII domain plus some intron sequences has also been reported for FGFR-1.
Mutations in FGFR-1 to -3 have been found in patients with birth defects involving craniosynostosis.
General Readings
  1. Eisemann et al., Oncogene 6:1195, 1991.
  2. Givol et al., FASEB J 6:3362, 1992.
Storage Store Lyophilized at -20°C to -70°C for greater than six months.
Reconstituted sFGFR-3a (IIIc)/Fc should be stored in working aliquots at -20°C.
Avoid repeated freeze-thaw cycles!
Description
Description:
Recombinant Human soluble FGFR-3 alpha (IIIc) was fused via a Xa cleavage site with the Fc part of Human IgG1.
Human recombinant soluble FGFR-3 alpha (IIIc)/Fc is a disulfide-linked heterodimeric protein. In the reduced form the glycosylated subunits of sFGFR-3 alpha/Human Fc chimera display a molecular mass of 80-85 kDa.
AA Sequence:
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLN ASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGPYWTRPERMDKKLLAVPAANTVRFR CPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPH RPILQAGLPANQTAVLGSDVEFHCKVSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHN VTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGDPRRASIEGRGDPEEPKSCDKTHTCPPCPAPELL GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Biological activity:
Determined by its ability to inhibit Human FGF acidic-dependent proliferation on R1 cells.
The ED50 for this effect is typically at 15.0-30.0 ng/ml.
Format
Buffer System:
PBS without stabilizers or preservatives.
Endotoxin level:
< 0.1 ng per µg of sFGF-R3a.
Purity:
>90% by SDS-PAGE and visualised by silver stain.
State:
Lyophilized purified protein.
Purified
Reconstitution:
Restore in PBS or medium to a concentration not lower than 50 µg/ml.
  • LinkedIn