DA3541 VEGFR-1 / Flt-1 (D1-D3)

Search for all "VEGFR-1 / Flt-1"

5 µg / €220.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

VEGFR-1 / Flt-1

DA3541

More Views

  • DA3541

Product Description for VEGFR-1 / Flt-1

VEGFR-1 / Flt-1.
Presentation: Purified

Properties for VEGFR-1 / Flt-1

Product Category Proteins & Growth Factors
Quantity 5 µg
Synonyms FLT, FLT1, FRT, Fms-like tyrosine kinase 1, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, VEGF Receptor 1, VEGFR1, Vascular endothelial growth factor receptor 1, Vascular permeability factor receptor
Presentation Purified
Molecular weight 45 kDa
Source Insect cells
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P17948
Purity > 90 % by SDS-PAGE and visualised by silver stain
Add. information Centrifuge vials before opening!
Background Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes, dendritic cells and on trophoblast cells. The flt-1 gene was first described in 1990. The receptor contains seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular splited tyrosine kinase domain. Compared to VEGFR-2 the Flt-1 receptor has a higher affinity for VEGF but a weaker signaling activity. VEGFR-1 thus leads not to proliferation of endothelial cells, but mediates signals for differentiation. Interestingly a naturally occuring soluble variant of VEGFR-1 (sVEGFR-1) was found in HUVE supernatants in 1996, which is generated by alternative splicing of the flt-1 mRNA.
The biological functions of sVEGFR-1 still are not clear, but it seems to be an endogenous regulator of angiogenesis, binding VEGF with the same affinity as the full-length receptor.
General Readings
  1. Barleon et al., 1997, J Biol Chem 272:10382-8.
  2. Röckl et al., 1998, Exp Cell Res, 241:161-170.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant human soluble Vascular Endothelial Growth Factor Receptor-1 domain D1-3 (sVEGFR-1D1-3) is produced as a non-chimeric protein in a monomeric form. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF. The receptor monomers have a mass of approximately 45 kDa containing 327 amino acid residues.
AA Sequence:
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHT GFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLI PDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTA TTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYD KAFITVKHRKQQVLETVAGKRSY
Biological activity:
The activity of sVEGFR-1 (D1-3) was determined by its ability to abolish the binding of iodinated VEGF to solid surfaces or cell surfaces receptors, and in Far-Western and cross-linking experiments with iodinated VEGF. 
Measured by its ability to inhibit the VEGF165-induced proliferation in human umbilical vein endothelial (HUVE) cells.
Molecular weight:
(Monomer)
Specific activity:
2.5 x 10e5 units/mg
Format
Buffer System:
PBS
Stabilizers:
None
Endotoxin level:
< 0.1 ng per µg of VEGF.
Purity:
>90% by SDS-PAGE and visualised by silver stain
State:
Lyophilized protein
Purified
Reconstitution:
The lyophilized sVEGFR-1D1-3 is soluble in water and most aqueous buffers and should be restore in PBS to a concentration of 100 ng/ml.
  • LinkedIn