Switch to Europe/Worldwide website Switch to German website Switch to French website Switch to OriGene Technologies, Inc. (North America)
Home » Neuroglobin

DP2017 Neuroglobin antibody

See related secondary antibodies

Search for all "Neuroglobin"

50 µg / €330.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

Chicken anti Canine, Human, Rat Neuroglobin

DP2017

Product Description for Neuroglobin

Chicken anti Canine, Human, Rat Neuroglobin.
Presentation: Aff - Purified
Product is tested for Frozen Sections, Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Neuroglobin

Product Category Primary Antibodies
Quantity 50 µg
Synonyms NGB
Presentation Aff - Purified
Reactivity Can, Hu, Rt
Applications C, E, WB
Clonality Polyclonal
Host Chicken
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NPG2
Immunogen:
Recombinant human neuroglobin.
The Human Neuroglobin is created as a recombinant protein produced in E. coli. It is the 17 kDa protein containing 150 amino acid residues of the Human Neuroglobin and one extra AA, N-terminal methionin.
The amino acid sequence of the recombinant human neuroglobin is 100% homologous with the amino acid sequence of the human neuroglobin.
AA Sequence:
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVT NVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPTRAAWSQLYGAVVQAMSRGWDGE
GeneID:
58157
Add. information Quality Control Test
Indirect ELISA - to determine titer of the antibody.
SDS PAGE - to determine purity of the antibody.
Application Western Blot.
Immunohistochemistry.
ELISA (for determination of the titer): The titer of this antibody, measured by indirect ELISA,  is >1:100,000 for antibody concentration 1 mg/ml, 25 ng of antigen are coated per well, and  defined at a point of maximal decrease of the titration curve.
Background Neuroglobin, a 151 amino acid reside protein, mainly expressed in vertebrate brain and retina, is a recently identified member of the globin superfamily. Augmenting O2 supply, neuroglobin promotes survival of neurons upon hypoxic injury, potentially limiting brain damage. Moreover, neuroglobin may be a novel oxidative stress-responsive sensor for signal transduction in the brain. Neuroglobin expression is increased by neuronal hypoxia in vitro and focal cerebral ischemia in vivo, and neuronal survival after hypoxia is reduced by inhibiting neuroglobin expression with an antisense oligodeoxynucleotide and enhanced by neuroglobin overexpression.
Concentration 1.0 mg/ml (after reconstitution)
General Readings
  1. Li RC, Lee SK, Pouranfar F, Brittian KR, Clair HB, Row BW, et al. Hypoxia differentially regulates the expression of neuroglobin and cytoglobin in rat brain. Brain Res. 2006 Jun 22;1096(1):173-9. Epub 2006 Jun 5. PubMed PMID: 16750520.
  2. Ostojić J, Sakaguchi DS, de Lathouder Y, Hargrove MS, Trent JT, Kwon YH, et al. Neuroglobin and cytoglobin: oxygen-binding proteins in retinal neurons. Invest Ophthalmol Vis Sci. 2006 Mar;47(3):1016-23. PubMed PMID: 16505036.
  3. Rajendram R, Rao NA. Neuroglobin in normal retina and retina from eyes with advanced glaucoma. Br J Ophthalmol. 2007 May;91(5):663-6. Epub 2006 Dec 6. PubMed PMID: 17151062. (Free PMC Article available, 3 images available)
  4. Pesce A, Dewilde S, Nardini M, Moens L, Ascenzi P, Hankeln T, et al. Human brain neuroglobin structure reveals a distinct mode of controlling oxygen affinity. Structure. 2003 Sep;11(9):1087-95. PubMed PMID: 12962627.
  5. Sun Y, Jin K, Mao XO, Zhu Y, Greenberg DA. Neuroglobin is up-regulated by and protects neurons from hypoxic-ischemic injury. Proc Natl Acad Sci U S A. 2001 Dec 18;98(26):15306-11. Epub 2001 Dec 11. PubMed PMID: 11742077. (Free PMC Article available, 3 images available)
  6. Sun Y, Jin K, Peel A, Mao XO, Xie L, Greenberg DA. Neuroglobin protects the brain from experimental stroke in vivo. Proc Natl Acad Sci U S A. 2003 Mar 18;100(6):3497-500. Epub 2003 Mar 5. PubMed PMID: 12621155. (Free PMC Article available, 4 images available)
  7. Mammen PP, Shelton JM, Goetsch SC, Williams SC, Richardson JA, Garry MG, et al. Neuroglobin, a novel member of the globin family, is expressed in focal regions of the brain. J Histochem Cytochem. 2002 Dec;50(12):1591-8. PubMed PMID: 12486081.
  8. Garry DJ, Mammen PP. Neuroprotection and the role of neuroglobin.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity chromatography on a column with immobilized recombinant Human Neuroglobin
Buffer System:
Azide Free,  0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2
Preservatives:
None
State:
Lyophilized purified IgG fraction
Aff - Purified
Reconstitution:
Restore with 0.05 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.
Specificity
Specificity:
This antibody recognizes Neuroglobin.
Species:
Human, Dog, Rat.
Gene ID 58157

Accessory Products

Proteins and/or Positive Controls

Proteins for Neuroglobin (3 products)

Catalog No. Species Pres. Purity   Source  

Neuroglobin
Neuroglobin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining. 		HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Neuroglobin
Neuroglobin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Neuroglobin
Neuroglobin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Neuroglobin (1 products)

Catalog No. Species Pres. Purity   Source  

Neuroglobin Lysate
Western Blot: Neuroglobin Lysate [NBL1-13631] - Western Blot experiments. Left-Control; Right -Over-expression Lysate for NGB
  Novus Biologicals Inc.

Recommended Secondary Antibodies for Neuroglobin (8 products)

Catalog No. Host Clone/Iso. Pres.   React. Applications  

Chicken IgG / Chicken IgY (H+L chain) antibody
Chicken IgG / Chicken IgY (H+L chain) antibody Rabbit AP
    OriGene Technologies GmbH

Chicken IgG / Chicken IgY (H+L chain) antibody
Chicken IgG / Chicken IgY (H+L chain) antibody Rabbit Biotin
    OriGene Technologies GmbH

Chicken IgG / Chicken IgY (H+L chain) antibody
Chicken IgG / Chicken IgY (H+L chain) antibody Rabbit FITC F, ICC/IF
    OriGene Technologies GmbH

Chicken IgG / Chicken IgY (H+L chain) antibody
Chicken IgG / Chicken IgY (H+L chain) antibody Rabbit HRP
    OriGene Technologies GmbH

Chicken IgG / Chicken IgY (H+L chain) antibody
Chicken IgG / Chicken IgY (H+L chain) antibody Rabbit TRITC
    OriGene Technologies GmbH

Chicken IgG / Chicken IgY (H+L chain), adsorbed antibody
Chicken IgG / Chicken IgY (H+L chain), adsorbed antibody Goat Cy2
    OriGene Technologies GmbH

Chicken IgG (H&L) multi-species ads. antibody
Chicken IgG (H&L) multi-species ads. antibody Goat Cy3
    OriGene Technologies GmbH

Chicken IgG / Chicken IgY (H+L chain, adsorbed) antibody
Chicken IgG / Chicken IgY (H+L chain, adsorbed) antibody Goat Cy5
    OriGene Technologies GmbH
Click here to see all secondary antibodies for Neuroglobin
Compare Products

You have no items to compare.

My Cart

You have no items in your shopping cart.

Service
  • OriGene Technologies GmbH
  • Schillerstraße 5
  • D-32052 Herford
  • Germany
  • phone: +49-5221-34606-0
  • free call: 0800-227 47 46 (Germany only)
  • fax: +49-5221-34606-11
  • email: info-de@origene.com
  • orders: ordering-de@origene.com
 
© Copyright 1998 - 2018 OriGene Technologies GmbH
  • LinkedIn